General Information

  • ID:  hor000205
  • Uniprot ID:  Q9U5D2
  • Protein name:  Crustacean hyperglycemic hormone 2
  • Gene name:  NA
  • Organism:  Penaeus japonicus (Kuruma prawn) (Marsupenaeus japonicus)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  medulla terminalis X-organ in the eyestalks
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVAMECRSNCYNNPVFRQCMEYLLPAHLHDEYRLAVQMV
  • Length:  72
  • Propeptide:  MIAFHMVWSALLASLLLLLLAPSASPVDAFSPPEASLTGGQSLSKRSLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVAMECRSNCYNNPVFRQCMEYLLPAHLHDEYRLAVQMVGK
  • Signal peptide:  MIAFHMVWSALLASLLLLLLAPSASPV
  • Modification:  T72 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-Q9U5D2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000205_AF2.pdbhor000205_ESM.pdb

Physical Information

Mass: 977039 Formula: C369H570N108O106S9
Absent amino acids: IKW Common amino acids: LRV
pI: 6.47 Basic residues: 10
Polar residues: 20 Hydrophobic residues: 23
Hydrophobicity: -22.5 Boman Index: -15795
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 75.69
Instability Index: 6350.69 Extinction Coefficient cystines: 4845
Absorbance 280nm: 68.24

Literature

  • PubMed ID:  9210164
  • Title:  Amino Acid Sequences and Activities of Multiple Hyperglycemic Hormones From the Kuruma Prawn, Penaeus Japonicus